Lineage for d3u40c_ (3u40 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2141907Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [189769] (2 PDB entries)
  8. 2141910Domain d3u40c_: 3u40 C: [196122]
    Other proteins in same PDB: d3u40d2
    automated match to d3u40d_
    complexed with adn, no3, po4

Details for d3u40c_

PDB Entry: 3u40 (more details), 2.05 Å

PDB Description: crystal structure of a purine nucleoside phosphorylase from entamoeba histolytica bound to adenosine
PDB Compounds: (C:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3u40c_:

Sequence, based on SEQRES records: (download)

>d3u40c_ c.56.2.0 (C:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv
klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf
erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl
avemeaaalymiaararkqalcmltisdlcygsgekmtaeerrtkftqmmevalslak

Sequence, based on observed residues (ATOM records): (download)

>d3u40c_ c.56.2.0 (C:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv
klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf
erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl
avemeaaalymiaararkqalcmltisdlcyerrtkftqmmevalslak

SCOPe Domain Coordinates for d3u40c_:

Click to download the PDB-style file with coordinates for d3u40c_.
(The format of our PDB-style files is described here.)

Timeline for d3u40c_: