Lineage for d2v4od_ (2v4o D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883008Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 1883009Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 1883025Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 1883026Protein automated matches [190619] (6 species)
    not a true protein
  7. 1883047Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)
  8. 1883070Domain d2v4od_: 2v4o D: [196120]
    automated match to d3ty2a_
    complexed with gol, mg, po4

Details for d2v4od_

PDB Entry: 2v4o (more details), 2.71 Å

PDB Description: crystal structure of salmonella typhimurium sure at 2.75 angstrom resolution in monoclinic form
PDB Compounds: (D:) multifunctional protein sur e

SCOPe Domain Sequences for d2v4od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4od_ c.106.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 99287]}
hgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtft
fdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrh
lgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtr
cgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahs
ahdvvsdwldsvgvgtqw

SCOPe Domain Coordinates for d2v4od_:

Click to download the PDB-style file with coordinates for d2v4od_.
(The format of our PDB-style files is described here.)

Timeline for d2v4od_: