Lineage for d1pir__ (1pir -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) 
Protein Phospholipase A2 [48637] (3 species) 
Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (9 PDB entries) 
Domain d1pir__: 1pir - [19611]
Details for d1pir__
PDB Entry: 1pir (more details)
PDB Description: solution structure of porcine pancreatic phospholipase a2
SCOP Domain Sequences for d1pir__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pir__ a.133.1.2 (-) Phospholipase A2 {Pig (Sus scrofa), pancreas}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc
SCOP Domain Coordinates for d1pir__:
Click to download the PDB-style file with coordinates for d1pir__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pir__:
- d1pir__ appears in SCOP 1.57
- d1pir__ appears in the current release, SCOPe 2.08, called d1pira_
View in 3D