Lineage for d3efwa_ (3efw A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221476Protein automated matches [190091] (10 species)
    not a true protein
  7. 1221597Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries)
  8. 1221837Domain d3efwa_: 3efw A: [196108]
    automated match to d3h10a_
    complexed with ak8, so4

Details for d3efwa_

PDB Entry: 3efw (more details), 2.29 Å

PDB Description: Structure of AuroraA with pyridyl-pyrimidine urea inhibitor
PDB Compounds: (A:) serine/threonine-protein kinase 6

SCOPe Domain Sequences for d3efwa_:

Sequence, based on SEQRES records: (download)

>d3efwa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records): (download)

>d3efwa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfldylppemiekvdlwslgvlcyeflvgkpp
feantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitanss

SCOPe Domain Coordinates for d3efwa_:

Click to download the PDB-style file with coordinates for d3efwa_.
(The format of our PDB-style files is described here.)

Timeline for d3efwa_: