Lineage for d3e5la_ (3e5l A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278253Species Streptomyces avermitilis [TaxId:33903] [189294] (5 PDB entries)
  8. 1278257Domain d3e5la_: 3e5l A: [196107]
    automated match to d2z36a_
    complexed with hem; mutant

Details for d3e5la_

PDB Entry: 3e5l (more details), 2.4 Å

PDB Description: Crystal structure of CYP105P1 H72A mutant
PDB Compounds: (A:) Cytochrome P450 (Cytochrome P450 hydroxylase)

SCOPe Domain Sequences for d3e5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e5la_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq
vphalatqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehl
daiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaag
mrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmi
glgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakg
eqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlf
rrlpglrlakpveelrfrhdmvfygvhelpvtwh

SCOPe Domain Coordinates for d3e5la_:

Click to download the PDB-style file with coordinates for d3e5la_.
(The format of our PDB-style files is described here.)

Timeline for d3e5la_: