![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces avermitilis [TaxId:33903] [189294] (7 PDB entries) |
![]() | Domain d3e5la1: 3e5l A:7-399 [196107] Other proteins in same PDB: d3e5la2 automated match to d2z36a_ complexed with hem; mutant |
PDB Entry: 3e5l (more details), 2.4 Å
SCOPe Domain Sequences for d3e5la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e5la1 a.104.1.0 (A:7-399) automated matches {Streptomyces avermitilis [TaxId: 33903]} daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq vphalatqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehl daiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaag mrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmi glgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakg eqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlf rrlpglrlakpveelrfrhdmvfygvhelpvtw
Timeline for d3e5la1: