SCOPe 2.05: Domain d3f7jb_: 3f7j B:

Lineage for d3f7jb_ (3f7j B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (24 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196103] (3 PDB entries)

8. Domain d3f7jb_: 3f7j B: [196104]
   automated match to d1vbja_
   complexed with k, no3

Details for d3f7jb_

PDB Entry: 3f7j, 1.7 Å

PDB Description: B.subtilis YvgN

PDB Compounds: (B:) YvgN protein

SCOPe Domain Sequences for d3f7jb_:

Sequence; same for both SEQRES and ATOM records:

>d3f7jb_ c.1.7.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mptslkdtvklhngvempwfglgvfkvengneatesvkaaikngyrsidtaaiykneegv
gigikesgvareelfitskvwnedqgyettlaafekslerlqldyldlylihwpgkdkyk
dtwraleklykdgkiraigvsnfqvhhleellkdaeikpmvnqvefhprltqkelrdyck
gqgiqleawsplmqgqlldnevltqiaekhnksvaqvilrwdlqhgvvtipksikehrii
enadifdfelsqedmdkidalnkdervgpnpdellf

Timeline for d3f7jb_:

• d3f7jb_ first appeared in SCOPe 2.02
  
• d3f7jb_ appears in SCOPe 2.04
  
• d3f7jb_ appears in SCOPe 2.06
  
• d3f7jb_ appears in the current release, SCOPe 2.08