Lineage for d3f42b_ (3f42 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007561Fold d.222: YbaB-like [82606] (1 superfamily)
    core: alpha-beta(3)-alpha, 2 layers:alpha/beta, three-stranded antiparallel beta sheet, strand order 123
  4. 3007562Superfamily d.222.1: YbaB-like [82607] (2 families) (S)
    forms tight dimer of a 3-layer structure: beta/alpha/beta
  5. 3007573Family d.222.1.0: automated matches [196098] (1 protein)
    not a true family
  6. 3007574Protein automated matches [196099] (2 species)
    not a true protein
  7. 3007578Species Helicobacter pylori [TaxId:210] [196100] (1 PDB entry)
  8. 3007580Domain d3f42b_: 3f42 B: [196101]
    Other proteins in same PDB: d3f42a2
    automated match to d1pugc_
    complexed with edo

Details for d3f42b_

PDB Entry: 3f42 (more details), 1.78 Å

PDB Description: Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
PDB Compounds: (B:) protein HP0035

SCOPe Domain Sequences for d3f42b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f42b_ d.222.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
glldgmkkefsqleeknkdtihtsksgggmvsvsfnglgelvdlqiddslledkeamqiy
lmsalndgykaveenrknlafnml

SCOPe Domain Coordinates for d3f42b_:

Click to download the PDB-style file with coordinates for d3f42b_.
(The format of our PDB-style files is described here.)

Timeline for d3f42b_: