Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.222: YbaB-like [82606] (1 superfamily) core: alpha-beta(3)-alpha, 2 layers:alpha/beta, three-stranded antiparallel beta sheet, strand order 123 |
Superfamily d.222.1: YbaB-like [82607] (2 families) forms tight dimer of a 3-layer structure: beta/alpha/beta |
Family d.222.1.0: automated matches [196098] (1 protein) not a true family |
Protein automated matches [196099] (2 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [196100] (1 PDB entry) |
Domain d3f42b_: 3f42 B: [196101] Other proteins in same PDB: d3f42a2 automated match to d1pugc_ complexed with edo |
PDB Entry: 3f42 (more details), 1.78 Å
SCOPe Domain Sequences for d3f42b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f42b_ d.222.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]} glldgmkkefsqleeknkdtihtsksgggmvsvsfnglgelvdlqiddslledkeamqiy lmsalndgykaveenrknlafnml
Timeline for d3f42b_: