SCOPe 2.08: Domain d3pt8b_: 3pt8 B:

Lineage for d3pt8b_ (3pt8 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Clam (Lucina pectinata) [TaxId:244486] [188300] (10 PDB entries)

8. Domain d3pt8b_: 3pt8 B: [196095]
   automated match to d3pt8a_
   complexed with cyn, fmt, gol, hem

Details for d3pt8b_

PDB Entry: 3pt8, 1.76 Å

PDB Description: Structure of HbII-III-CN from Lucina pectinata at pH 5.0

PDB Compounds: (B:) Hemoglobin III

SCOPe Domain Sequences for d3pt8b_:

Sequence; same for both SEQRES and ATOM records:

>d3pt8b_ a.1.1.0 (B:) automated matches {Clam (Lucina pectinata) [TaxId: 244486]}
ssgltgpqkaalksswsrfmnnavtngtnfymdlfkaypdtltpfkslfqnvsfnqmtnh
ptmkaqslvfcngmssfvdnlddhevlvvllqkmaklhfnrgirikelrdgygtllryle
dhchvegstknawedfiayicrvqgdfmkerl

Timeline for d3pt8b_:

• d3pt8b_ first appeared in SCOPe 2.02
  
• d3pt8b_ appears in SCOPe 2.07