Lineage for d3pt8b_ (3pt8 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689415Species Clam (Lucina pectinata) [TaxId:244486] [188300] (10 PDB entries)
  8. 2689417Domain d3pt8b_: 3pt8 B: [196095]
    automated match to d3pt8a_
    complexed with cyn, fmt, gol, hem

Details for d3pt8b_

PDB Entry: 3pt8 (more details), 1.76 Å

PDB Description: Structure of HbII-III-CN from Lucina pectinata at pH 5.0
PDB Compounds: (B:) Hemoglobin III

SCOPe Domain Sequences for d3pt8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pt8b_ a.1.1.0 (B:) automated matches {Clam (Lucina pectinata) [TaxId: 244486]}
ssgltgpqkaalksswsrfmnnavtngtnfymdlfkaypdtltpfkslfqnvsfnqmtnh
ptmkaqslvfcngmssfvdnlddhevlvvllqkmaklhfnrgirikelrdgygtllryle
dhchvegstknawedfiayicrvqgdfmkerl

SCOPe Domain Coordinates for d3pt8b_:

Click to download the PDB-style file with coordinates for d3pt8b_.
(The format of our PDB-style files is described here.)

Timeline for d3pt8b_: