SCOPe 2.03: Domain d3elkb_: 3elk B:

Lineage for d3elkb_ (3elk B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [196079] (1 PDB entry)

8. Domain d3elkb_: 3elk B: [196080]
   automated match to d3hhha_
   complexed with cl

Details for d3elkb_

PDB Entry: 3elk, 1.7 Å

PDB Description: crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum

PDB Compounds: (B:) Putative transcriptional regulator TA0346

SCOPe Domain Sequences for d3elkb_:

Sequence, based on SEQRES records:

>d3elkb_ a.4.5.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
erilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvises
svnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

Sequence, based on observed residues (ATOM records):

>d3elkb_ a.4.5.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
erilhglitlyilkelvkrpmhgyelqksmfettgqalpgsiyillktmkergfvisess
vnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd

Timeline for d3elkb_:

• d3elkb_ first appeared in SCOPe 2.02
  
• d3elkb_ appears in SCOPe 2.04
  
• d3elkb_ appears in the current release, SCOPe 2.08