Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (19 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:2303] [196079] (1 PDB entry) |
Domain d3elkb_: 3elk B: [196080] automated match to d3hhha_ complexed with cl |
PDB Entry: 3elk (more details), 1.7 Å
SCOPe Domain Sequences for d3elkb_:
Sequence, based on SEQRES records: (download)
>d3elkb_ a.4.5.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} erilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvises svnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd
>d3elkb_ a.4.5.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} erilhglitlyilkelvkrpmhgyelqksmfettgqalpgsiyillktmkergfvisess vnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd
Timeline for d3elkb_: