Lineage for d3p2pb_ (3p2p B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) 
Protein Phospholipase A2 [48637] (3 species) 
Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (9 PDB entries) 
Domain d3p2pb_: 3p2p B: [19608]
Details for d3p2pb_
PDB Entry: 3p2p (more details), 2.1 Å
PDB Description: enhanced activity and altered specificity of phospholipase a2 by deletion of a surface loop
SCOP Domain Sequences for d3p2pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p2pb_ a.133.1.2 (B:) Phospholipase A2 {Pig (Sus scrofa), pancreas}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc
SCOP Domain Coordinates for d3p2pb_:
Click to download the PDB-style file with coordinates for d3p2pb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p2pb_:
- d3p2pb_ appears in SCOP 1.57
- d3p2pb_ appears in the current release, SCOPe 2.08
View in 3D
