Lineage for d4dgad_ (4dga D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717885Domain d4dgad_: 4dga D: [196072]
    Other proteins in same PDB: d4dgaa_, d4dgab_
    automated match to d1m9dc_

Details for d4dgad_

PDB Entry: 4dga (more details), 1.9 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: HIV-1 CA(O-loop) complex
PDB Compounds: (D:) capsid protein

SCOPe Domain Sequences for d4dgad_:

Sequence, based on SEQRES records: (download)

>d4dgad_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrthppamgplppgqireptgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkiv

Sequence, based on observed residues (ATOM records): (download)

>d4dgad_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqm
lketineeaaewdrthppamgplppgqireptgsdiagttstlqeqigwmthnppipvge
iykrwiilglnkiv

SCOPe Domain Coordinates for d4dgad_:

Click to download the PDB-style file with coordinates for d4dgad_.
(The format of our PDB-style files is described here.)

Timeline for d4dgad_: