SCOP 1.71: Domain d5p2pb_: 5p2p B:

Lineage for d5p2pb_ (5p2p B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Phospholipase A2 [48637] (4 species)

7. Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (13 PDB entries)

8. Domain d5p2pb_: 5p2p B: [19606]
   complexed with ca, dhg; mutant

Details for d5p2pb_

PDB Entry: 5p2p, 2.4 Å

PDB Description: x-ray structure of phospholipase a2 complexed with a substrate-derived inhibitor

SCOP Domain Sequences for d5p2pb_:

Sequence; same for both SEQRES and ATOM records:

>d5p2pb_ a.133.1.2 (B:) Phospholipase A2 {Pig (Sus scrofa), pancreas}
alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc

Timeline for d5p2pb_:

• d5p2pb_ first appeared (with stable ids) in SCOP 1.55
  
• d5p2pb_ appears in SCOP 1.69
  
• d5p2pb_ appears in SCOP 1.73
  
• d5p2pb_ appears in the current release, SCOPe 2.08