Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (40 species) not a true protein |
Species Thunnus atlanticus [TaxId:48168] [187921] (8 PDB entries) |
Domain d3qm7a_: 3qm7 A: [196059] automated match to d2nrla_ complexed with cmo, edo, hem |
PDB Entry: 3qm7 (more details), 0.96 Å
SCOPe Domain Sequences for d3qm7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qm7a_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]} adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg qtalrnvmgiiiadleanykelgfs
Timeline for d3qm7a_: