SCOPe 2.05: Domain d3qzub_: 3qzu B:

Lineage for d3qzub_ (3qzu B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein automated matches [190277] (10 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [196055] (1 PDB entry)

8. Domain d3qzub_: 3qzu B: [196056]
   automated match to d1i6wb_
   complexed with cl, gol, so4; mutant

Details for d3qzub_

PDB Entry: 3qzu, 1.85 Å

PDB Description: Crystal structure of Bacillus subtilis Lipase A 7-fold mutant; the outcome of directed evolution towards thermostability

PDB Compounds: (B:) Lipase estA

SCOPe Domain Sequences for d3qzub_:

Sequence; same for both SEQRES and ATOM records:

>d3qzub_ c.69.1.18 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
ehnpvvmvhgiggasfnfagiksylvsqgwsqndlyavdfwdktgtnynngpvlsrfvqk
vldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgdalpgtdpnq
kilytsiyssaddivmnclsrldgarnvqihgvghmgllyssqvnslikeglngggqntn

Timeline for d3qzub_:

• d3qzub_ first appeared in SCOPe 2.02
  
• d3qzub_ appears in SCOPe 2.04
  
• d3qzub_ appears in SCOPe 2.06
  
• d3qzub_ appears in the current release, SCOPe 2.08