Lineage for d3ri7e_ (3ri7 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978075Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2978076Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2978077Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2978091Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 2978092Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)
  8. 2978096Domain d3ri7e_: 3ri7 E: [196052]
    Other proteins in same PDB: d3ri7a_, d3ri7c_
    automated match to d3dhie_
    complexed with act, fe; mutant

Details for d3ri7e_

PDB Entry: 3ri7 (more details), 2.1 Å

PDB Description: Toluene 4 monooxygenase HD Mutant G103L
PDB Compounds: (E:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d3ri7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ri7e_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
tladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrk
tleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d3ri7e_:

Click to download the PDB-style file with coordinates for d3ri7e_.
(The format of our PDB-style files is described here.)

Timeline for d3ri7e_: