SCOPe 2.06: Domain d5p2pa_: 5p2p A:

Lineage for d5p2pa_ (5p2p A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Phospholipase A2 [48637] (5 species)

7. Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (23 PDB entries)

8. Domain d5p2pa_: 5p2p A: [19605]
   complexed with ca, dhg

Details for d5p2pa_

PDB Entry: 5p2p, 2.4 Å

PDB Description: x-ray structure of phospholipase a2 complexed with a substrate-derived inhibitor

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d5p2pa_:

Sequence; same for both SEQRES and ATOM records:

>d5p2pa_ a.133.1.2 (A:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc

Timeline for d5p2pa_:

• d5p2pa_ first appeared (with stable ids) in SCOP 1.55
  
• d5p2pa_ appears in SCOPe 2.05
  
• d5p2pa_ appears in SCOPe 2.07
  
• d5p2pa_ appears in the current release, SCOPe 2.08