Lineage for d5p2pa_ (5p2p A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2732922Protein Phospholipase A2 [48637] (5 species)
  7. 2733006Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (23 PDB entries)
  8. 2733030Domain d5p2pa_: 5p2p A: [19605]
    complexed with ca, dhg

Details for d5p2pa_

PDB Entry: 5p2p (more details), 2.4 Å

PDB Description: x-ray structure of phospholipase a2 complexed with a substrate-derived inhibitor
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d5p2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5p2pa_ a.133.1.2 (A:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc

SCOPe Domain Coordinates for d5p2pa_:

Click to download the PDB-style file with coordinates for d5p2pa_.
(The format of our PDB-style files is described here.)

Timeline for d5p2pa_: