SCOPe 2.03: Domain d3rmkc_: 3rmk C:

Lineage for d3rmkc_ (3rmk C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.0: automated matches [191572] (1 protein)
   not a true family

6. Protein automated matches [190991] (1 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:300] [188696] (14 PDB entries)

8. Domain d3rmkc_: 3rmk C: [196048]
   Other proteins in same PDB: d3rmka_, d3rmkd_
   automated match to d3ge3c_
   complexed with bml, ca, fe, pge

Details for d3rmkc_

PDB Entry: 3rmk, 1.95 Å

PDB Description: toluene 4 monooxygenase h with 4-bromophenol

PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3rmkc_:

Sequence; same for both SEQRES and ATOM records:

>d3rmkc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvf

Timeline for d3rmkc_:

• d3rmkc_ first appeared in SCOPe 2.02
  
• d3rmkc_ appears in SCOPe 2.04
  
• d3rmkc_ appears in the current release, SCOPe 2.08