Lineage for d4ai4a_ (4ai4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721131Family a.96.1.0: automated matches [191469] (1 protein)
    not a true family
  6. 2721132Protein automated matches [190736] (2 species)
    not a true protein
  7. 2721140Species Staphylococcus aureus [TaxId:282459] [196040] (2 PDB entries)
  8. 2721141Domain d4ai4a_: 4ai4 A: [196042]
    automated match to d2jg6a_
    complexed with so4, zn; mutant

Details for d4ai4a_

PDB Entry: 4ai4 (more details), 1.73 Å

PDB Description: crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus
PDB Compounds: (A:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d4ai4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ai4a_ a.96.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282459]}
mnecafgtkdpvylnyhdhvwgqplydskalfkllalqsqhaglswltilkkkeayeeaf
ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
skpkhn

SCOPe Domain Coordinates for d4ai4a_:

Click to download the PDB-style file with coordinates for d4ai4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ai4a_: