SCOPe 2.05: Domain d4ai5c_: 4ai5 C:

Lineage for d4ai5c_ (4ai5 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.0: automated matches [191469] (1 protein)
   not a true family

6. Protein automated matches [190736] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282459] [196040] (2 PDB entries)

8. Domain d4ai5c_: 4ai5 C: [196041]
   automated match to d2jg6a_
   protein/DNA complex; complexed with adk, so4, zn

Details for d4ai5c_

PDB Entry: 4ai5, 2.22 Å

PDB Description: crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine

PDB Compounds: (C:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d4ai5c_:

Sequence; same for both SEQRES and ATOM records:

>d4ai5c_ a.96.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 282459]}
mnecafgtkdpvylnfhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf
ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
skpkhn

Timeline for d4ai5c_:

• d4ai5c_ first appeared in SCOPe 2.02
  
• d4ai5c_ appears in SCOPe 2.04
  
• d4ai5c_ appears in SCOPe 2.06
  
• d4ai5c_ appears in the current release, SCOPe 2.08