Lineage for d3skpa_ (3skp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522358Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2522505Protein automated matches [190754] (1 species)
    not a true protein
  7. 2522506Species Human (Homo sapiens) [TaxId:9606] [187949] (3 PDB entries)
  8. 2522507Domain d3skpa_: 3skp A: [196028]
    automated match to d2haua1
    complexed with so4

Details for d3skpa_

PDB Entry: 3skp (more details), 1.7 Å

PDB Description: The structure of apo-human transferrin C-lobe with bound sulfate ions
PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d3skpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3skpa_ c.94.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ckpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyi
agkcglvpvlaenynksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrta
gwnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygyt
gafrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanch
larapnhavvtrkdkeacvhkilrqqqhlfgsnvtdcsgnfclfrsetkdllfrddtvcl
aklhdrntyekylgeeyvkavgnlrkcstsslleactf

SCOPe Domain Coordinates for d3skpa_:

Click to download the PDB-style file with coordinates for d3skpa_.
(The format of our PDB-style files is described here.)

Timeline for d3skpa_: