![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
![]() | Protein automated matches [190754] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187949] (3 PDB entries) |
![]() | Domain d3skpa_: 3skp A: [196028] automated match to d2haua1 complexed with so4 |
PDB Entry: 3skp (more details), 1.7 Å
SCOPe Domain Sequences for d3skpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3skpa_ c.94.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ckpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldggfvyi agkcglvpvlaenynksdncedtpeagyfavavvkksasdltwdnlkgkkschtavgrta gwnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegyygyt gafrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveeyanch larapnhavvtrkdkeacvhkilrqqqhlfgsnvtdcsgnfclfrsetkdllfrddtvcl aklhdrntyekylgeeyvkavgnlrkcstsslleactf
Timeline for d3skpa_: