| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein Interleukin-21 (IL-21) [158425] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158426] (2 PDB entries) Uniprot Q9HBE4 23-155 |
| Domain d3tgxp_: 3tgx P: [196025] automated match to d2oqpa1 complexed with man, ni, so4 |
PDB Entry: 3tgx (more details), 2.8 Å
SCOPe Domain Sequences for d3tgxp_:
Sequence, based on SEQRES records: (download)
>d3tgxp_ a.26.1.2 (P:) Interleukin-21 (IL-21) {Human (Homo sapiens) [TaxId: 9606]}
drhmirmrqlidivdqlknyvndlvpeflpapedvetncewsafscfqkaqlksantgnn
eriinvsikklkrkppstnagrrqkhrltcpscdsyekkppkeflerfksllqkmihqhl
>d3tgxp_ a.26.1.2 (P:) Interleukin-21 (IL-21) {Human (Homo sapiens) [TaxId: 9606]}
drhmirmrqlidivdqlknyvndlvpeflpapedvetncewsafscfqkaqlksantgnn
eriinvsikklkrkppsttcpscdsyekkppkeflerfksllqkmihqhl
Timeline for d3tgxp_: