Lineage for d4aiac_ (4aia C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721131Family a.96.1.0: automated matches [191469] (1 protein)
    not a true family
  6. 2721132Protein automated matches [190736] (2 species)
    not a true protein
  7. 2721133Species Staphylococcus aureus [TaxId:1280] [187912] (2 PDB entries)
  8. 2721136Domain d4aiac_: 4aia C: [196017]
    Other proteins in same PDB: d4aiaa2, d4aiad2, d4aiae2
    automated match to d2jg6a_
    complexed with adk, so4, zn

Details for d4aiac_

PDB Entry: 4aia (more details), 1.8 Å

PDB Description: The structural basis of 3-methyladenine recognition by 3- methyladenine DNA glycosylase I (TAG) from Staphylococcus aureus
PDB Compounds: (C:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d4aiac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aiac_ a.96.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mnecafgtkdpvylnyhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf
ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
skpkhn

SCOPe Domain Coordinates for d4aiac_:

Click to download the PDB-style file with coordinates for d4aiac_.
(The format of our PDB-style files is described here.)

Timeline for d4aiac_: