| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein automated matches [190085] (59 species) not a true protein |
| Species Bacillus megaterium [TaxId:1404] [195340] (5 PDB entries) |
| Domain d3autb1: 3aut B:1-261 [196016] Other proteins in same PDB: d3auta2, d3autb2 automated match to d1gcoa_ complexed with nai |
PDB Entry: 3aut (more details), 2 Å
SCOPe Domain Sequences for d3autb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3autb1 c.2.1.2 (B:1-261) automated matches {Bacillus megaterium [TaxId: 1404]}
mytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggqai
ivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnltga
flgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyapkg
irvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasyvt
gitlfadggmtkypsfqagrg
Timeline for d3autb1: