Lineage for d4d9qb_ (4d9q B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2797046Species Macaca mulatta [TaxId:9541] [196009] (1 PDB entry)
  8. 2797048Domain d4d9qb_: 4d9q B: [196010]
    Other proteins in same PDB: d4d9qd1, d4d9qd2, d4d9qe_, d4d9qh_, d4d9ql1, d4d9ql2
    automated match to d1bioa_
    complexed with gol, so4, zn

Details for d4d9qb_

PDB Entry: 4d9q (more details), 2.28 Å

PDB Description: inhibiting alternative pathway complement activation by targeting the exosite on factor d
PDB Compounds: (B:) factor d

SCOPe Domain Sequences for d4d9qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d9qb_ b.47.1.2 (B:) automated matches {Macaca mulatta [TaxId: 9541]}
ilggreaeaharpymasvqvngehlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsrpdtidhdllllqlsekatlgpavrplpwqrvdrdvepg
tlcdvagwgivshagrrpdrlqhvllpvldratcnrrthhdgaitqrmmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d4d9qb_:

Click to download the PDB-style file with coordinates for d4d9qb_.
(The format of our PDB-style files is described here.)

Timeline for d4d9qb_: