Lineage for d3qt4a_ (3qt4 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155543Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [189891] (2 PDB entries)
  8. 2155546Domain d3qt4a_: 3qt4 A: [196002]
    automated match to d3qj3a_
    complexed with pg4, pg6, po4

Details for d3qt4a_

PDB Entry: 3qt4 (more details), 2.11 Å

PDB Description: structure of digestive procathepsin l 3 of tenebrio molitor larval midgut
PDB Compounds: (A:) Cathepsin-L-like midgut cysteine proteinase

SCOPe Domain Sequences for d3qt4a_:

Sequence, based on SEQRES records: (download)

>d3qt4a_ d.3.1.0 (A:) automated matches {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
kslfqeqwsqfklthkksysspieeirrqlifkdnvakiaehnakfekgevtyskamnqf
gdmskeeflayvnrgkaqkpkhpenlrmpyvsskkplaasvdwrsnavsevkdqgqcgss
wsfsttgavegqlalqrgrltslseqnlidcsssygnagcdggwmdsafsyihdygimse
saypyeaqgdycrfdssqsvttlsgyydlpsgdensladavgqagpvavaidatdelqfy
sgglfydqtcnqsdlnhgvlvvgygsdngqdywilknswgsgwgesgywrqvrnygnncg
iataasypal

Sequence, based on observed residues (ATOM records): (download)

>d3qt4a_ d.3.1.0 (A:) automated matches {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
kslfqeqwsqfklthkksysspieeirrqlifkdnvakiaehnakfekgevtyskamnqf
gdmskeeflayvnrgkaqnlrmpyvsskkplaasvdwrsnavsevkdqgqcgsswsfstt
gavegqlalqrgrltslseqnlidcsssygnagcdggwmdsafsyihdygimsesaypye
aqgdycrfdssqsvttlsgyydlpsgdensladavgqagpvavaidatdelqfysgglfy
dqtcnqsdlnhgvlvvgygsdngqdywilknswgsgwgesgywrqvrnygnncgiataas
ypal

SCOPe Domain Coordinates for d3qt4a_:

Click to download the PDB-style file with coordinates for d3qt4a_.
(The format of our PDB-style files is described here.)

Timeline for d3qt4a_: