Lineage for d3tb3b_ (3tb3 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192500Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1192501Protein automated matches [190230] (10 species)
    not a true protein
  7. 1192512Species Human (Homo sapiens) [TaxId:9606] [187072] (10 PDB entries)
  8. 1192518Domain d3tb3b_: 3tb3 B: [195997]
    automated match to d3riia_
    complexed with ca

Details for d3tb3b_

PDB Entry: 3tb3 (more details), 2.3 Å

PDB Description: crystal structure of the uch domain of uch-l5 with 6 residues deleted
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase isozyme L5

SCOPe Domain Sequences for d3tb3b_:

Sequence, based on SEQRES records: (download)

>d3tb3b_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpi
dlgacnqddwisavrpviekriqkysegeirfnlmaivsd

Sequence, based on observed residues (ATOM records): (download)

>d3tb3b_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp
viekriqkysegeirfnlmaivsd

SCOPe Domain Coordinates for d3tb3b_:

Click to download the PDB-style file with coordinates for d3tb3b_.
(The format of our PDB-style files is described here.)

Timeline for d3tb3b_: