Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) |
Family d.68.6.0: automated matches [191549] (1 protein) not a true family |
Protein automated matches [190948] (1 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [188545] (2 PDB entries) |
Domain d3u6yc_: 3u6y C: [195996] automated match to d2h9ua_ protein/DNA complex; complexed with po4 |
PDB Entry: 3u6y (more details), 2 Å
SCOPe Domain Sequences for d3u6yc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u6yc_ d.68.6.0 (C:) automated matches {Aeropyrum pernix [TaxId: 272557]} macegapevrigrkpvmnyvlailttlmeqgtnqvvvkargrninravdaveivrkrfak nieikdikidsqeievqtpegqtrtrrvssieiclekag
Timeline for d3u6yc_: