Lineage for d3ub0c_ (3ub0 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724803Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1725057Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) (S)
  5. 1725069Family a.8.9.0: automated matches [195991] (1 protein)
    not a true family
  6. 1725070Protein automated matches [195992] (1 species)
    not a true protein
  7. 1725071Species Feline infectious peritonitis virus [TaxId:33734] [195993] (1 PDB entry)
  8. 1725073Domain d3ub0c_: 3ub0 C: [195994]
    automated match to d1ysya1
    protein/RNA complex

Details for d3ub0c_

PDB Entry: 3ub0 (more details), 2.6 Å

PDB Description: crystal structure of the nonstructural protein 7 and 8 complex of feline coronavirus
PDB Compounds: (C:) Non-structural protein 7, nsp7

SCOPe Domain Sequences for d3ub0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ub0c_ a.8.9.0 (C:) automated matches {Feline infectious peritonitis virus [TaxId: 33734]}
gskltemkctnvvllgllskmhvesnskewnycvglhneinlcddpdavlekllaliaff
lskhntcdlsdliesyfentti

SCOPe Domain Coordinates for d3ub0c_:

Click to download the PDB-style file with coordinates for d3ub0c_.
(The format of our PDB-style files is described here.)

Timeline for d3ub0c_: