SCOPe 2.08: Domain d3ub0c1: 3ub0 C:1-81

Lineage for d3ub0c1 (3ub0 C:1-81)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families)

5. Family a.8.9.0: automated matches [195991] (1 protein)
   not a true family

6. Protein automated matches [195992] (1 species)
   not a true protein

7. Species Feline infectious peritonitis virus [TaxId:33734] [195993] (1 PDB entry)

8. Domain d3ub0c1: 3ub0 C:1-81 [195994]
   Other proteins in same PDB: d3ub0c2, d3ub0f2
   automated match to d1ysya1
   protein/RNA complex

Details for d3ub0c1

PDB Entry: 3ub0, 2.6 Å

PDB Description: crystal structure of the nonstructural protein 7 and 8 complex of feline coronavirus

PDB Compounds: (C:) Non-structural protein 7, nsp7

SCOPe Domain Sequences for d3ub0c1:

Sequence; same for both SEQRES and ATOM records:

>d3ub0c1 a.8.9.0 (C:1-81) automated matches {Feline infectious peritonitis virus [TaxId: 33734]}
skltemkctnvvllgllskmhvesnskewnycvglhneinlcddpdavlekllaliaffl
skhntcdlsdliesyfentti

Timeline for d3ub0c1:

• d3ub0c1 first appeared in SCOPe 2.02, called d3ub0c_
  
• d3ub0c1 appears in SCOPe 2.07