Lineage for d3umjb_ (3umj B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151835Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2151916Protein automated matches [190277] (10 species)
    not a true protein
  7. 2151946Species Geobacillus zalihae [TaxId:213419] [187349] (3 PDB entries)
  8. 2151952Domain d3umjb_: 3umj B: [195990]
    automated match to d1ji3a_
    complexed with ca, cl, gol, na, zn

Details for d3umjb_

PDB Entry: 3umj (more details), 2.1 Å

PDB Description: Crystal Structure of D311E Lipase
PDB Compounds: (B:) Thermostable lipase

SCOPe Domain Sequences for d3umjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umjb_ c.69.1.18 (B:) automated matches {Geobacillus zalihae [TaxId: 213419]}
slrandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwd
raceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarm
lvsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrff
dlqkavleaaavasnvpytsqvydfkldqwglrrqpgesfdhyferlkrspvwtstdtar
ydlsvsgaeklnqwvqaspntyylsfstertyrgaltgnhypelgmnafsavvcapflgs
yrnptlgiderwlendgivntvsmngpkrgssdrivpydgtlkkgvwndmgtynvdhlei
igvdpnpsfdirafylrlaeqlaslqp

SCOPe Domain Coordinates for d3umjb_:

Click to download the PDB-style file with coordinates for d3umjb_.
(The format of our PDB-style files is described here.)

Timeline for d3umjb_: