SCOPe 2.06: Domain d3uypb_: 3uyp B:

Lineage for d3uypb_ (3uyp B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Dengue virus 4 [TaxId:11070] [195988] (4 PDB entries)

8. Domain d3uypb_: 3uyp B: [195989]
   Other proteins in same PDB: d3uypa1, d3uypa2
   automated match to d2jsfa1
   complexed with gol, so4, trs

Details for d3uypb_

PDB Entry: 3uyp, 2 Å

PDB Description: Crystal structure of the dengue virus serotype 4 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d3uypb_:

Sequence; same for both SEQRES and ATOM records:

>d3uypb_ b.1.18.0 (B:) automated matches {Dengue virus 4 [TaxId: 11070]}
ytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfa
entnsvtnieleppfgdsyivigvgdsaltlhwfrk

Timeline for d3uypb_:

• d3uypb_ first appeared in SCOPe 2.02
  
• d3uypb_ appears in SCOPe 2.05
  
• d3uypb_ appears in SCOPe 2.07
  
• d3uypb_ appears in the current release, SCOPe 2.08