| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (43 species) not a true protein |
| Species Dengue virus 4 [TaxId:11070] [195988] (4 PDB entries) |
| Domain d3uypb_: 3uyp B: [195989] Other proteins in same PDB: d3uypa1, d3uypa2 automated match to d2jsfa1 complexed with gol, so4, trs |
PDB Entry: 3uyp (more details), 2 Å
SCOPe Domain Sequences for d3uypb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uypb_ b.1.18.0 (B:) automated matches {Dengue virus 4 [TaxId: 11070]}
ytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfa
entnsvtnieleppfgdsyivigvgdsaltlhwfrk
Timeline for d3uypb_: