Lineage for d3uzva_ (3uzv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765495Protein automated matches [190183] (10 species)
    not a true protein
  7. 2765505Species Dengue virus 2 [TaxId:11064] [195986] (1 PDB entry)
  8. 2765506Domain d3uzva_: 3uzv A: [195987]
    Other proteins in same PDB: d3uzvb1, d3uzvb2
    automated match to d2jsfa1
    complexed with eoh

Details for d3uzva_

PDB Entry: 3uzv (more details), 2.1 Å

PDB Description: Crystal structure of the dengue virus serotype 2 envelope protein domain III in complex with the variable domains of Mab 4E11
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d3uzva_:

Sequence, based on SEQRES records: (download)

>d3uzva_ b.1.18.4 (A:) automated matches {Dengue virus 2 [TaxId: 11064]}
mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitv
npivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Sequence, based on observed residues (ATOM records): (download)

>d3uzva_ b.1.18.4 (A:) automated matches {Dengue virus 2 [TaxId: 11064]}
mgmsysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeimdlhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d3uzva_:

Click to download the PDB-style file with coordinates for d3uzva_.
(The format of our PDB-style files is described here.)

Timeline for d3uzva_: