SCOPe 2.08: Domain d3uzqb_: 3uzq B:

Lineage for d3uzqb_ (3uzq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (10 species)
   not a true protein

7. Species Dengue virus 1 [TaxId:11053] [195098] (4 PDB entries)

8. Domain d3uzqb_: 3uzq B: [195985]
   Other proteins in same PDB: d3uzqa1, d3uzqa2, d3uzqa3
   automated match to d2jsfa1
   complexed with edo, gol, mes

Details for d3uzqb_

PDB Entry: 3uzq, 1.6 Å

PDB Description: Crystal structure of the dengue virus serotype 1 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d3uzqb_:

Sequence; same for both SEQRES and ATOM records:

>d3uzqb_ b.1.18.4 (B:) automated matches {Dengue virus 1 [TaxId: 11053]}
yvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgvtqngrlitanpiv
tdkekpvnieteppfgesyiivgagekalklswfk

Timeline for d3uzqb_:

• d3uzqb_ first appeared in SCOPe 2.02
  
• d3uzqb_ appears in SCOPe 2.07