Lineage for d3uzqb_ (3uzq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765495Protein automated matches [190183] (10 species)
    not a true protein
  7. 2765496Species Dengue virus 1 [TaxId:11053] [195098] (4 PDB entries)
  8. 2765497Domain d3uzqb_: 3uzq B: [195985]
    Other proteins in same PDB: d3uzqa1, d3uzqa2, d3uzqa3
    automated match to d2jsfa1
    complexed with edo, gol, mes

Details for d3uzqb_

PDB Entry: 3uzq (more details), 1.6 Å

PDB Description: Crystal structure of the dengue virus serotype 1 envelope protein domain III in complex with the variable domains of Mab 4E11
PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d3uzqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uzqb_ b.1.18.4 (B:) automated matches {Dengue virus 1 [TaxId: 11053]}
yvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgvtqngrlitanpiv
tdkekpvnieteppfgesyiivgagekalklswfk

SCOPe Domain Coordinates for d3uzqb_:

Click to download the PDB-style file with coordinates for d3uzqb_.
(The format of our PDB-style files is described here.)

Timeline for d3uzqb_: