| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
| Family d.38.1.6: FabZ-like [110902] (1 protein) automatically mapped to Pfam PF07977 |
| Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
| Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries) Uniprot Q965D7 84-229! Uniprot Q965D7 94-229 |
| Domain d3az9w_: 3az9 W: [195967] automated match to d1z6bf_ complexed with gol, k91, po4 |
PDB Entry: 3az9 (more details), 2.75 Å
SCOPe Domain Sequences for d3az9w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3az9w_ d.38.1.6 (W:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
iaklsgvgyvngkvvinisemtfal
Timeline for d3az9w_: