SCOPe 2.02: Domain d4dida_: 4did A:

Lineage for d4dida_ (4did A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (27 PDB entries)

8. Domain d4dida_: 4did A: [195960]
   automated match to d1ajea_
   complexed with gdp, mg

Details for d4dida_

PDB Entry: 4did, 2.35 Å

PDB Description: Crystal structure of Salmonella effector N-terminal domain SopB in complex with Cdc42

PDB Compounds: (A:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d4dida_:

Sequence; same for both SEQRES and ATOM records:

>d4dida_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalep

Timeline for d4dida_:

• d4dida_ is new in SCOPe 2.02-stable
  
• d4dida_ appears in SCOPe 2.03
  
• d4dida_ appears in the current release, SCOPe 2.08