SCOPe 2.08: Domain d4dq0c1: 4dq0 C:1-197

Lineage for d4dq0c1 (4dq0 C:1-197)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.44: TehB-like [142603] (2 proteins)
   Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)

6. Protein automated matches [191226] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189643] (2 PDB entries)

8. Domain d4dq0c1: 4dq0 C:1-197 [195956]
   Other proteins in same PDB: d4dq0b2, d4dq0c2
   automated match to d2xvma_
   complexed with nhe

Details for d4dq0c1

PDB Entry: 4dq0, 2.2 Å

PDB Description: The crystal structure of tellurite resistance protein from Escherichia coli O157:H7 str. Sakai

PDB Compounds: (C:) Tellurite resistance protein

SCOPe Domain Sequences for d4dq0c1:

Sequence; same for both SEQRES and ATOM records:

>d4dq0c1 c.66.1.44 (C:1-197) automated matches {Escherichia coli [TaxId: 562]}
miirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdk
namsianveriksienldnlhtrvvdlnnltfdgeydfilstvvlmfleaktipglianm
qrctkpggynlivaamdtadypctvgfpfafkegelrryyegwemvkynedvgelhrtda
ngnriklrfatmlarkk

Timeline for d4dq0c1:

• d4dq0c1 first appeared in SCOPe 2.02, called d4dq0c_
  
• d4dq0c1 appears in SCOPe 2.07