SCOPe 2.07: Domain d3ql2b_: 3ql2 B:

Lineage for d3ql2b_ (3ql2 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)

8. Domain d3ql2b_: 3ql2 B: [195951]
   automated match to d1kf3a_
   complexed with so4

Details for d3ql2b_

PDB Entry: 3ql2, 1.49 Å

PDB Description: Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3ql2b_:

Sequence; same for both SEQRES and ATOM records:

>d3ql2b_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketcaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitecretgsskypncaykttqankhiivacegnpyvpchf
dasv

Timeline for d3ql2b_:

• d3ql2b_ first appeared in SCOPe 2.02
  
• d3ql2b_ appears in SCOPe 2.06
  
• d3ql2b_ appears in the current release, SCOPe 2.08