Lineage for d3ed5a_ (3ed5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920292Species Bacillus subtilis [TaxId:1423] [188499] (5 PDB entries)
  8. 2920293Domain d3ed5a_: 3ed5 A: [195946]
    automated match to d3i76b_
    complexed with fmt

Details for d3ed5a_

PDB Entry: 3ed5 (more details), 1.72 Å

PDB Description: The crystal structure of YfnB from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (A:) YfnB

SCOPe Domain Sequences for d3ed5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ed5a_ c.108.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegk
mtrdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyi
vtngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliig
dsltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnient

SCOPe Domain Coordinates for d3ed5a_:

Click to download the PDB-style file with coordinates for d3ed5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ed5a_: