Lineage for d3sxca_ (3sxc A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178199Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1178200Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1178492Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
  6. 1178533Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 1178534Species Human (Homo sapiens) [TaxId:9606] [75277] (37 PDB entries)
    Uniprot P16442 64-345
  8. 1178568Domain d3sxca_: 3sxc A: [195939]
    automated match to d2rj1a_
    complexed with gal, mn, peg, udp

Details for d3sxca_

PDB Entry: 3sxc (more details), 1.9 Å

PDB Description: crystal structure of bbbb+udp+gal with glycerol as the cryoprotectant
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3sxca_:

Sequence, based on SEQRES records: (download)

>d3sxca_ c.68.1.9 (A:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrw
qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssr
eaftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwh
deshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpkn

Sequence, based on observed residues (ATOM records): (download)

>d3sxca_ c.68.1.9 (A:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgmrrme
miscerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqs
qayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllr
hkptkvlspeylwdqqllgwpavlrklrftavpkn

SCOPe Domain Coordinates for d3sxca_:

Click to download the PDB-style file with coordinates for d3sxca_.
(The format of our PDB-style files is described here.)

Timeline for d3sxca_:

  • d3sxca_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-28
  • d3sxca_ appears in SCOPe 2.03
  • d3sxca_ appears in the current release, SCOPe 2.07, called d3sxca1