SCOPe 2.06: Domain d3cmia_: 3cmi A:

Lineage for d3cmia_ (3cmi A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (13 PDB entries)

8. Domain d3cmia_: 3cmi A: [195934]
   automated match to d2p5qa_

Details for d3cmia_

PDB Entry: 3cmi, 2.02 Å

PDB Description: Crystal structure of glutathione-dependent phospholipid peroxidase Hyr1 from the yeast Saccharomyces cerevisiae

PDB Compounds: (A:) Peroxiredoxin HYR1

SCOPe Domain Sequences for d3cmia_:

Sequence, based on SEQRES records:

>d3cmia_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sefyklapvdkkgqpfpfdqlkgkvvlivnvaskcgftpqykelealykrykdegftiig
fpcnqfghqepgsdeeiaqfcqlnygvtfpimkkidvnggnedpvykflksqksgmlglr
gikwnfekflvdkkgkvyeryssltkpsslsetieellkev

Sequence, based on observed residues (ATOM records):

>d3cmia_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sefyklapvdkkgqpfpfdqlkgkvvlivnvaskcgftpqykelealykrykdegftiig
fpcnqfggvtfpimkkidvnggnedpvykflksqksgmlglrgikwnfekflvdkkgkvy
eryssltkpsslsetieellkev

Timeline for d3cmia_:

• d3cmia_ first appeared in SCOPe 2.02
  
• d3cmia_ appears in SCOPe 2.05
  
• d3cmia_ appears in SCOPe 2.07
  
• d3cmia_ appears in the current release, SCOPe 2.08