Lineage for d1c74a_ (1c74 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51243Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 51244Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 51249Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 51259Protein Phospholipase A2 [48637] (3 species)
  7. 51260Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (21 PDB entries)
  8. 51273Domain d1c74a_: 1c74 A: [19593]

Details for d1c74a_

PDB Entry: 1c74 (more details), 1.9 Å

PDB Description: Structure of the double mutant (K53,56M) of phospholipase A2

SCOP Domain Sequences for d1c74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c74a_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
knc

SCOP Domain Coordinates for d1c74a_:

Click to download the PDB-style file with coordinates for d1c74a_.
(The format of our PDB-style files is described here.)

Timeline for d1c74a_: