![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (7 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [195917] (2 PDB entries) |
![]() | Domain d3unbv_: 3unb V: [195924] Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_ automated match to d1irui_ complexed with 04c |
PDB Entry: 3unb (more details), 2.9 Å
SCOPe Domain Sequences for d3unbv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3unbv_ d.153.1.4 (V:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis snlelhslttgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd klpyvtmgsgslaamavfedkfrpdmeeeeakklvseaiaagifndlgsgsnidlcvisk skldflrpfsvpnkkgtrlgryrcekgttavltekvtple
Timeline for d3unbv_:
![]() Domains from other chains: (mouse over for more information) d3unb1_, d3unb2_, d3unb3_, d3unb4_, d3unba_, d3unbb_, d3unbc_, d3unbd_, d3unbe_, d3unbf_, d3unbg_, d3unbh_, d3unbi_, d3unbj_, d3unbk_, d3unbl_, d3unbm_, d3unbn_, d3unbo_, d3unbp_, d3unbq_, d3unbr_, d3unbs_, d3unbt_, d3unbu_, d3unbw_, d3unbx_, d3unby_, d3unbz_ |