Lineage for d3unby_ (3unb Y:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995169Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries)
  8. 2995213Domain d3unby_: 3unb Y: [195922]
    Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
    automated match to d1irul_
    complexed with 04c

Details for d3unby_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d3unby_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unby_ d.153.1.4 (Y:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
edgwirvssdnvadlhdkyss

SCOPe Domain Coordinates for d3unby_:

Click to download the PDB-style file with coordinates for d3unby_.
(The format of our PDB-style files is described here.)

Timeline for d3unby_: