Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (8 species) not a true protein |
Species Mus musculus [TaxId:10090] [195917] (2 PDB entries) |
Domain d3unbc_: 3unb c: [195918] Other proteins in same PDB: d3unbu_ automated match to d1irub_ complexed with 04c |
PDB Entry: 3unb (more details), 2.9 Å
SCOPe Domain Sequences for d3unbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3unbc_ d.153.1.4 (c:) automated matches {Mus musculus [TaxId: 10090]} akrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned leledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaa
Timeline for d3unbc_: