![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein automated matches [190141] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187124] (4 PDB entries) |
![]() | Domain d3ux9c_: 3ux9 C: [195915] Other proteins in same PDB: d3ux9b1, d3ux9b2, d3ux9d1, d3ux9d2 automated match to d1itfa_ |
PDB Entry: 3ux9 (more details), 2.8 Å
SCOPe Domain Sequences for d3ux9c_:
Sequence, based on SEQRES records: (download)
>d3ux9c_ a.26.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldnrrtlmllaqmsrispssclmdrhdfgfpqeefdgnqfqkapaisvlheliqqifnlf ttkdssaawdedlldkfctelyqqlndleacvmqeervgetplmnadsilavkkyfrrit lyltekkyspcawevvraeimrslslst
>d3ux9c_ a.26.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldnrrtlmllaqmsrispssclmdrhdfgfpqeefpaisvlheliqqifnlfttkdssaa wdedlldkfctelyqqlndleacvmnadsilavkkyfrritlyltekkyspcawevvrae imrslslst
Timeline for d3ux9c_: